DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NLaz and APOD

DIOPT Version :9

Sequence 1:NP_001259867.1 Gene:NLaz / 33324 FlyBaseID:FBgn0053126 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001638.1 Gene:APOD / 347 HGNCID:612 Length:189 Species:Homo sapiens


Alignment Length:189 Identity:73/189 - (38%)
Similarity:101/189 - (53%) Gaps:7/189 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLISVVFGAVWVAHAQVPFPGKCPDVKLLDTFDAEAYMGVWYEYAAYPFAFEIGKKCIYANYS 73
            ||||:|.:.|....|..|....||||:..:.:.||...|:|.|||....|..||.| :||.||||
Human     4 LLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENG-RCIQANYS 67

  Fly    74 LIDNSTVSVVNAAINRFTGQPSNVTGQA---KVLGPGQLAVAFYPTQPLTKANYLVLGTDYESYA 135
            |::|..:.|:|..: |..|..:.:.|:|   .:..|.:|.|.|....|  .|.|.:|.||||:||
Human    68 LMENGKIKVLNQEL-RADGTVNQIEGEATPVNLTEPAKLEVKFSWFMP--SAPYWILATDYENYA 129

  Fly   136 VVYSCTSVTPLANFKIVWILTRQREPSAEAVDAARKILEDNDVSQAFLIDTVQKNCPRL 194
            :|||||.:..|.:....|||.|......|.||:.:.||..|::....:..|.|.|||:|
Human   130 LVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NLazNP_001259867.1 Lipocalin 36..164 CDD:304412 49/130 (38%)
APODNP_001638.1 lipocalin_apoD-like 25..182 CDD:381212 60/160 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I7748
eggNOG 1 0.900 - - E1_COG3040
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1246
Inparanoid 1 1.050 126 1.000 Inparanoid score I4708
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47731
OrthoDB 1 1.010 - - D1631943at2759
OrthoFinder 1 1.000 - - FOG0002020
OrthoInspector 1 1.000 - - oto89190
orthoMCL 1 0.900 - - OOG6_101844
Panther 1 1.100 - - O PTHR10612
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1154
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.880

Return to query results.
Submit another query.