DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NLaz and rbp4l

DIOPT Version :9

Sequence 1:NP_001259867.1 Gene:NLaz / 33324 FlyBaseID:FBgn0053126 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_956259.1 Gene:rbp4l / 335651 ZFINID:ZDB-GENE-030131-7591 Length:196 Species:Danio rerio


Alignment Length:136 Identity:34/136 - (25%)
Similarity:61/136 - (44%) Gaps:13/136 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VWVAHAQVPFPGKC--PDVKLLDTFDAEAYMGVWY-EYAAYPFAFEIGKKCIYANYSLIDNSTVS 81
            |::::.:..|...|  ....:.|.||.:.|.|.|| :....|....: :..|.|.|::.|:.|::
Zfish    11 VFLSYIERCFSASCAVESFTVKDDFDPKRYAGKWYAQQKKDPEGLFL-QDNISAEYTIDDDGTMT 74

  Fly    82 VVN---AAINRFTGQPSNVTGQAKVLGPGQLAVAFYPTQPLTK------ANYLVLGTDYESYAVV 137
            ..:   ..:..|....:::..|..|..|...|..|...|.|..      .||.|:.|||::||:.
Zfish    75 ASSKGRVTLFGFWVVCADMAAQYSVPDPTTPAKMFMNYQGLASYLSSGGDNYWVIDTDYDNYAIT 139

  Fly   138 YSCTSV 143
            |:|.::
Zfish   140 YACRTL 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NLazNP_001259867.1 Lipocalin 36..164 CDD:304412 31/118 (26%)
rbp4lNP_956259.1 Lipocalin 41..175 CDD:278490 27/106 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1631943at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.