DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NLaz and CG31659

DIOPT Version :9

Sequence 1:NP_001259867.1 Gene:NLaz / 33324 FlyBaseID:FBgn0053126 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_722702.1 Gene:CG31659 / 318875 FlyBaseID:FBgn0051659 Length:192 Species:Drosophila melanogaster


Alignment Length:179 Identity:47/179 - (26%)
Similarity:77/179 - (43%) Gaps:27/179 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FPGKCP-DVKLLDTFDAEAYMGVWYEYAAYPFAFEIGKKCIYANYSLIDNSTVSVVNAAINRFTG 92
            |.|.|| ::..:...|.:.:.|.||.::.||......:||...::...:.:..|||...:|..||
  Fly    23 FHGACPSNMTAVGDLDMDRFKGKWYTHSIYPHLSLRVEKCQSTDFIEKEENKFSVVARELNTQTG 87

  Fly    93 QPS-------NVTGQ--AKVLGPGQLAVAFYPTQPLTKANYLVLGTDYESYAVVYSCTSVTPLAN 148
            ...       ||..:  ..|||....|   :|...|    ..||.|||.::|:.:.|...:.:.:
  Fly    88 TVKMRKADILNVEPEFGRYVLGTTSTA---FPEGVL----MYVLDTDYVNFAIRFMCFDASKIFS 145

  Fly   149 FKIVWILTRQREPSAEAVDAARKI-----LEDNDVSQAFLIDTVQKNCP 192
            |....|.||:|.||.:.:..|:..     |...|:|:     ..|::||
  Fly   146 FHWAVIQTRKRLPSTQVIHMAQYFGKSAGLVIGDMSK-----VPQESCP 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NLazNP_001259867.1 Lipocalin 36..164 CDD:304412 36/136 (26%)
CG31659NP_722702.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471697
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3040
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1631943at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101844
Panther 1 1.100 - - P PTHR10612
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.