DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NLaz and rbp4l

DIOPT Version :9

Sequence 1:NP_001259867.1 Gene:NLaz / 33324 FlyBaseID:FBgn0053126 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001090773.1 Gene:rbp4l / 100037859 XenbaseID:XB-GENE-5839942 Length:196 Species:Xenopus tropicalis


Alignment Length:167 Identity:37/167 - (22%)
Similarity:64/167 - (38%) Gaps:58/167 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HLLLLISVVFGAVWVAHAQVPFPGKCPDVKLLDTFDAEAYMGVWYEYAAYPFAFEIGKK------ 66
            |||||:.:.......|.:.|     ..::.:.:..|.:.|.|.||         .||||      
 Frog     6 HLLLLVLLTIYEQCNAQSCV-----VDNIPVKENLDLKRYAGKWY---------GIGKKDPEGLF 56

  Fly    67 ---CIYANYSLIDNSTVSVVNAAINRFTGQPSNVTGQAKVLG----PGQLAVAFYPTQPLTKA-- 122
               .|.|:|::.::.|:.             ::..|:.|:.|    ..::|..:....|...|  
 Frog    57 LQDNISADYTVEEDGTMI-------------ASSKGRVKLFGFWLICAEMAAQYTVPDPSIPAKM 108

  Fly   123 ----------------NYLVLGTDYESYAVVYSCTSV 143
                            ||.|:.|||::||:.|:|.|:
 Frog   109 YMTYQGLASYLSSGGDNYWVIDTDYDNYAITYACRSL 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NLazNP_001259867.1 Lipocalin 36..164 CDD:304412 30/139 (22%)
rbp4lNP_001090773.1 lipocalin_FABP 24..196 CDD:385686 31/149 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1631943at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.