DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5556 and DOG1

DIOPT Version :9

Sequence 1:NP_001285559.1 Gene:CG5556 / 33320 FlyBaseID:FBgn0031332 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_011910.1 Gene:DOG1 / 856440 SGDID:S000001086 Length:246 Species:Saccharomyces cerevisiae


Alignment Length:206 Identity:41/206 - (19%)
Similarity:69/206 - (33%) Gaps:58/206 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CIFDLESAVFDTRHVYKRAVIELAASYNKIIPEAVLIKSGPMETAEMAELICRKCD-------LP 87
            |:|||:..:..|....::|..:|...|. :.|..:...|....|.|:......|.|       |.
Yeast     9 CLFDLDGTIVSTTVAAEKAWTKLCYEYG-VDPSELFKHSHGARTQEVLRRFFPKLDDTDNKGVLA 72

  Fly    88 VSWESFRFQLNERTSDLIANPTLMPGVERLVTHLGRCCMGLGLITSCSESMYCTKIRDR------ 146
            :.        .:.....:...:|:||.|.|:       :.|.:.|...:     |:.:|      
Yeast    73 LE--------KDIAHSYLDTVSLIPGAENLL-------LSLDVDTETQK-----KLPERKWAIVT 117

  Fly   147 -----------EDFFQNFSS-VICADDADLKAPKPEPDVYLIAMRRLGDAGPDCTL--------- 190
                       |...:|... .:.....|:|..||:|:.|..|...|..   |..|         
Yeast   118 SGSPYLAFSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQ---DLQLTGKQDLKYV 179

  Fly   191 VFDGTPKGVQA 201
            ||:..|.|::|
Yeast   180 VFEDAPVGIKA 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5556NP_001285559.1 HAD_2 30..212 CDD:290155 41/206 (20%)
HAD_like 40..249 CDD:304363 37/196 (19%)
DOG1NP_011910.1 HAD_ScGPP-like 9..231 CDD:319829 41/206 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0637
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.