DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5556 and AT2G38740

DIOPT Version :10

Sequence 1:NP_608595.2 Gene:CG5556 / 33320 FlyBaseID:FBgn0031332 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_565895.1 Gene:AT2G38740 / 818456 AraportID:AT2G38740 Length:244 Species:Arabidopsis thaliana


Alignment Length:65 Identity:24/65 - (36%)
Similarity:36/65 - (55%) Gaps:6/65 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 DFFQNFSSVICADDADLKAPKPEPDVYLIAMRRLGDAGPDCTLVFDGTPKGVQAATDARLPVVML 212
            ||||   :||...:.:.  |||.|..||.|:..| :...:.||||:.:..|::|...|.:||:.|
plant   149 DFFQ---AVILGSECEF--PKPHPGPYLKALEVL-NVSKEHTLVFEDSISGIKAGVAAGMPVIGL 207

  Fly   213  212
            plant   208  207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5556NP_608595.2 Haloacid Dehalogenase-like Hydrolases 40..249 CDD:473868 24/65 (37%)
AT2G38740NP_565895.1 PLN02770 1..244 CDD:215413 24/65 (37%)

Return to query results.
Submit another query.