DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5556 and pudp

DIOPT Version :9

Sequence 1:NP_001285559.1 Gene:CG5556 / 33320 FlyBaseID:FBgn0031332 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001018451.1 Gene:pudp / 553642 ZFINID:ZDB-GENE-050522-36 Length:214 Species:Danio rerio


Alignment Length:216 Identity:67/216 - (31%)
Similarity:112/216 - (51%) Gaps:5/216 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LESAVFDTRHVYKRAVIELAASYNKIIPEAVLIKSGPM--ETAEMAELICRKCDLPVSWESFRFQ 96
            ::..:.||..:|..:..|:...:||.....|  ||..|  :..:.|.:|..|..||::.|....:
Zfish     1 MDGLLLDTERLYTVSFQEVCDRFNKQYTWEV--KSSVMGKKALDAARIIRDKIGLPMTPEELLEE 63

  Fly    97 LNERTSDLIANPTLMPGVERLVTHLGRCCMGLGLITSCSESMYCTKIRDREDFFQNFSSVICADD 161
            ..:....|....:|:||||:||.||.:..:.:.:.||.:...:..|....::||..||.::..||
Zfish    64 TRKIQERLFPTTSLLPGVEKLVNHLHKHGIPIAVGTSSAGLTFEMKTSRHKEFFSLFSHIVLGDD 128

  Fly   162 ADLKAPKPEPDVYLIAMRRLG-DAGPDCTLVFDGTPKGVQAATDARLPVVMLAEKDLPCCWSELA 225
            .|:|..||.||.:|:..:|.. .|.|:..|||:..|.||:|...|.:.|||:.:.:|....::.|
Zfish   129 PDVKNGKPLPDTFLVCAKRFSPPANPEQCLVFEDAPNGVKAGLAAGMQVVMIPDDNLDRSLTQEA 193

  Fly   226 TLRLETLEEFDPAEFNMPPYS 246
            ||.|.::|:|.|..|.:|.|:
Zfish   194 TLLLRSMEDFRPELFGLPAYA 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5556NP_001285559.1 HAD_2 30..212 CDD:290155 55/180 (31%)
HAD_like 40..249 CDD:304363 67/210 (32%)
pudpNP_001018451.1 HAD_like 1..213 CDD:304363 66/213 (31%)
PGMB-YQAB-SF 1..180 CDD:213673 55/180 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595564
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0637
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18901
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.