DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5556 and pudp

DIOPT Version :9

Sequence 1:NP_001285559.1 Gene:CG5556 / 33320 FlyBaseID:FBgn0031332 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_017946702.1 Gene:pudp / 496806 XenbaseID:XB-GENE-946266 Length:240 Species:Xenopus tropicalis


Alignment Length:233 Identity:72/233 - (30%)
Similarity:121/233 - (51%) Gaps:19/233 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SPGISYCIFDLESAVF--DTRHVYKRAVIELAASYNK----IIPEAVLIKSGPMETAEMAELICR 82
            |.|.::...::.|:..  ||..:|.....|:...:.|    .:...|:.|    :....||:|..
 Frog    15 SKGNNFASCNINSSGIKGDTERLYTVVFQEICNRFGKEYTWDVKSLVMGK----KALPAAEIIRD 75

  Fly    83 KCDLPVSWESFRFQLNE---RTSDLIANPTLMPGVERLVTHLGRCCMGLGLITSCSESMYCTKIR 144
            ...||::.|..   |||   :..::....:||||||:|:.||.:..:.:.:.||.::..:..|..
 Frog    76 VLALPMTAEEL---LNESRIKQEEIFPTASLMPGVEKLIYHLNKHNIPIAVATSSAKVTFEMKTS 137

  Fly   145 DREDFFQNFSSVICADDADLKAPKPEPDVYLIAMRRLGDAGP--DCTLVFDGTPKGVQAATDARL 207
            ..:|||..|..::..||.|:|..||:||.:|:..:|. :..|  |..|||:..|.||:||..|.:
 Frog   138 KHKDFFNLFHHIVLGDDPDVKNGKPQPDSFLVCAKRF-NPPPRLDKCLVFEDAPNGVEAALTAGM 201

  Fly   208 PVVMLAEKDLPCCWSELATLRLETLEEFDPAEFNMPPY 245
            .|||:.:::|....::.|||.|:::|||.|..|.:|||
 Frog   202 QVVMIPDENLNPDLTKKATLVLKSMEEFQPELFGLPPY 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5556NP_001285559.1 HAD_2 30..212 CDD:290155 56/192 (29%)
HAD_like 40..249 CDD:304363 69/215 (32%)
pudpXP_017946702.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18901
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.