DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5556 and Gs1l

DIOPT Version :9

Sequence 1:NP_001285559.1 Gene:CG5556 / 33320 FlyBaseID:FBgn0031332 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_477228.1 Gene:Gs1l / 33653 FlyBaseID:FBgn0019982 Length:231 Species:Drosophila melanogaster


Alignment Length:223 Identity:70/223 - (31%)
Similarity:112/223 - (50%) Gaps:4/223 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ISYCIFDLESAVFDTRHVYKRAVIELAASYNKIIPEAVLIKSGPMETAEMAELICRKCDLPVSWE 91
            :::|:||::..:.||..:|..|...:...|.|..|..:..:...::|..:|..:....:||:|||
  Fly     9 VTHCVFDMDGLLLDTERLYTVATEMILEPYGKTYPFEIKEQVMGLQTEPLARFMVEHYELPMSWE 73

  Fly    92 SFRFQLNERTSDLIANPTLMPGVERLVTHLGRCCMGLGLITSCSESMYCTKIRDREDFFQNFSSV 156
            .:..|....|..|:.|..||||.|||:.||....:...|.||....|...|.....:.|..|:..
  Fly    74 EYARQQRANTEILMRNAQLMPGAERLLRHLHANKVPFCLATSSGADMVELKTAQHRELFSLFNHK 138

  Fly   157 IC-ADDADLKAPKPEPDVYLIAMRRLG--DAGPDCTLVFDGTPKGVQAATDARLPVVMLAEKDLP 218
            :| :.|.::...||.||::|:|..|.|  ....|| |||:.:|.||.||..|.:.|||:.:..|.
  Fly   139 VCGSSDKEVVNGKPAPDIFLVAAGRFGVPPKPSDC-LVFEDSPNGVTAANSAGMQVVMVPDPRLS 202

  Fly   219 CCWSELATLRLETLEEFDPAEFNMPPYS 246
            ...:..||..|.:|.:|.|.:|.:|.::
  Fly   203 QEKTSHATQVLASLADFKPEQFGLPAFT 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5556NP_001285559.1 HAD_2 30..212 CDD:290155 60/184 (33%)
HAD_like 40..249 CDD:304363 67/210 (32%)
Gs1lNP_477228.1 YcjU 12..220 CDD:223710 66/208 (32%)
HAD_like 16..231 CDD:304363 67/216 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469706
Domainoid 1 1.000 78 1.000 Domainoid score I467
eggNOG 1 0.900 - - E1_COG0637
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I371
Isobase 1 0.950 - 0 Normalized mean entropy S1244
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18901
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.