DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5556 and CG5561

DIOPT Version :9

Sequence 1:NP_001285559.1 Gene:CG5556 / 33320 FlyBaseID:FBgn0031332 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_608596.1 Gene:CG5561 / 33321 FlyBaseID:FBgn0031333 Length:305 Species:Drosophila melanogaster


Alignment Length:298 Identity:190/298 - (63%)
Similarity:234/298 - (78%) Gaps:9/298 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCSACCKSCKAPPGCSLCPPMCCSPGISYCIFDLESAVFDTRHVYKRAVIELAASYNKIIPEAVL 65
            ||:..|::||:.|.|..|.|.||||.|||||||||||||||||||::|:.||...|:|.||:.:.
  Fly     1 MCTFGCRTCKSQPDCEGCSPKCCSPCISYCIFDLESAVFDTRHVYRKALKELVRCYDKRIPDILH 65

  Fly    66 IKSGPMETAEMAELICRKCDLPVSWESFRFQLNERTSDLIANPTLMPGVERLVTHLGRCCMGLGL 130
            ::||||..:||:||.|||.|:|:||||||::||||||.|||||..|.|:||||.||...||.|||
  Fly    66 VQSGPMTISEMSELFCRKLDIPMSWESFRYELNERTSHLIANPPFMDGIERLVPHLRNSCMELGL 130

  Fly   131 ITSCSESMYCTKIRDREDFFQNFSSVICADDADLKAPKPEPDVYLIAMRRLGDAGPDCTLVFDGT 195
            |||.:|:.||:|||.|||||:|||:|:||||.:|:|||||||||||||.||||||||||||||||
  Fly   131 ITSSNEANYCSKIRGREDFFENFSTVVCADDPELRAPKPEPDVYLIAMSRLGDAGPDCTLVFDGT 195

  Fly   196 PKGVQAATDARLPVVMLAEKDLPCCWSELATLRLETLEEFDPAEFNMPPYSCTEPPPKKPKASSH 260
            |||||||:||||||:|||||||||||||||.||.|.|::|:|..:|:||:  |:|.||:      
  Fly   196 PKGVQAASDARLPVIMLAEKDLPCCWSELAALRFEYLDDFEPEMYNLPPF--TDPAPKR------ 252

  Fly   261 RSS-QKSAGSQRGSAALKKAAADSEADEGEEEEGEGQE 297
            ||| :::..|||.:....:||..:.|:|.|.||.|..|
  Fly   253 RSSRRRTRYSQRLTVIRARAAEAAAAEEAEAEEEEPAE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5556NP_001285559.1 HAD_2 30..212 CDD:290155 131/181 (72%)
HAD_like 40..249 CDD:304363 145/208 (70%)
CG5561NP_608596.1 HAD_2 30..212 CDD:290155 131/181 (72%)
HAD_like 75..247 CDD:304363 128/173 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469705
Domainoid 1 1.000 78 1.000 Domainoid score I467
eggNOG 1 0.900 - - E1_COG0637
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I371
Isobase 1 0.950 - 0 Normalized mean entropy S1244
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510544at2759
OrthoFinder 1 1.000 - - FOG0019572
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18901
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.