DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5556 and Pudp

DIOPT Version :9

Sequence 1:NP_001285559.1 Gene:CG5556 / 33320 FlyBaseID:FBgn0031332 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001099616.1 Gene:Pudp / 291585 RGDID:1305101 Length:234 Species:Rattus norvegicus


Alignment Length:224 Identity:66/224 - (29%)
Similarity:108/224 - (48%) Gaps:9/224 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ISYCIFDLESAVFDTRHVYKRAVIELAASYNK----IIPEAVLIKSGPMETAEMAELICRKCDLP 87
            :::.||||:..:.:|..:|......:.:.|.|    .:...|:.|..|    |..::|.....||
  Rat    13 VTHLIFDLDGLLLNTEDLYTDVFQAICSRYGKKYNWDVKSLVMGKKAP----ETTQIIVDFLKLP 73

  Fly    88 VSWESFRFQLNERTSDLIANPTLMPGVERLVTHLGRCCMGLGLITSCSESMYCTKIRDREDFFQN 152
            :|.|....:..||...::....||||.|.|:.||.:..:...|.||.:...:.||....:.||..
  Rat    74 ISKEQLLEESQERLQKVLHTAALMPGAEELIHHLRKNRLPFALATSSATLSFQTKTSRYKGFFSL 138

  Fly   153 FSSVICADDADLKAPKPEPDVYLIAMRRLG-DAGPDCTLVFDGTPKGVQAATDARLPVVMLAEKD 216
            |..::..||.::...||.||::|...:|.. ...|:..|||:.:|.||:||....:.|||:..::
  Rat   139 FHHIVLGDDPEVINSKPAPDIFLTCAKRFSPPPNPEDCLVFEDSPNGVEAAVACGMQVVMVPHEN 203

  Fly   217 LPCCWSELATLRLETLEEFDPAEFNMPPY 245
            |....:..|||.|.:|.||.|..|.:|.:
  Rat   204 LSSDLTTKATLVLSSLHEFKPELFGLPAF 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5556NP_001285559.1 HAD_2 30..212 CDD:290155 54/186 (29%)
HAD_like 40..249 CDD:304363 62/211 (29%)
PudpNP_001099616.1 HAD_AtGPP-like 13..201 CDD:319831 55/191 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353434
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0637
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18901
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.