DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5556 and R151.10

DIOPT Version :9

Sequence 1:NP_001285559.1 Gene:CG5556 / 33320 FlyBaseID:FBgn0031332 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001379936.1 Gene:R151.10 / 24104817 WormBaseID:WBGene00020113 Length:233 Species:Caenorhabditis elegans


Alignment Length:241 Identity:67/241 - (27%)
Similarity:112/241 - (46%) Gaps:34/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ISYCIFDLESAVFDTRHVYKRAVIELAASYNKIIPEAVLIKSGPMETAEMAELICRKCDLPVSW- 90
            :::.|||.:..:.||...|..|.:||...|..:.       :..::..:|.    ::.|..:.| 
 Worm     5 VTHVIFDFDGLLVDTESAYTEANMELLRKYGHVF-------TMDLKRRQMG----KRHDESIRWL 58

  Fly    91 ------------ESFRFQLNERTSDLIANPTLMPGVERLVTHLGRCCMGLGLIT-SCSESMYCTK 142
                        |.:..|.:|...::......|||.|:||.||....:.:.|.| |||.: :.||
 Worm    59 INELKIGDLVTPEEYSRQYDELLIEMFKRSPAMPGAEKLVRHLLHTGVPVALCTGSCSRT-FPTK 122

  Fly   143 IRDREDFFQNFS-SVICADDADLKAPKPEPDVYLIAMRRLGDA--GPDCTLVFDGTPKGVQAATD 204
            :.:.:|:..... .|:..||.::|..||.||.:|:.|:|....  ..|..|||:.:..||.:|.|
 Worm   123 LDNHKDWVNMIKLQVLSGDDPEVKHGKPHPDPFLVTMKRFPQVPESADKVLVFEDSYNGVLSALD 187

  Fly   205 ARLPVVMLAEKDL--PCCWSEL---ATLRLETLEEFDPAEFNMPPY 245
            |.:..||:.|:.:  |....|.   .|:.|.:||:|.|.:|.:|||
 Worm   188 AGMQCVMVPERSIFDPDSDPEFKNRVTVILNSLEQFKPEDFGLPPY 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5556NP_001285559.1 HAD_2 30..212 CDD:290155 53/198 (27%)
HAD_like 40..249 CDD:304363 64/228 (28%)
R151.10NP_001379936.1 HAD_AtGPP-like 5..197 CDD:319831 54/203 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167025
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0637
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18901
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.