DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdlc2 and DYN2

DIOPT Version :10

Sequence 1:NP_477408.1 Gene:Cdlc2 / 33319 FlyBaseID:FBgn0026141 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_010712.1 Gene:DYN2 / 852034 SGDID:S000002832 Length:92 Species:Saccharomyces cerevisiae


Alignment Length:91 Identity:44/91 - (48%)
Similarity:67/91 - (73%) Gaps:3/91 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDRK---AVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKYNPTWHCIVGRNF 62
            |||..   .::|.:|:::::::|.:..:..||:||.:|:|||..:||:.|.||..|||.|||:||
Yeast     1 MSDENKSTPIVKASDITDKLKEDILTISKDALDKYQLERDIAGTVKKQLDVKYGNTWHVIVGKNF 65

  Fly    63 GSYVTHETRHFIYFYLGQVAILLFKS 88
            |||||||..||:|||:|.:|.|:||:
Yeast    66 GSYVTHEKGHFVYFYIGPLAFLVFKT 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdlc2NP_477408.1 DLC-like_DYNLL1_DYNLL2 5..88 CDD:412000 40/85 (47%)
DYN2NP_010712.1 DLC-like_DYNLL1_DYNLL2 8..91 CDD:412000 40/82 (49%)

Return to query results.
Submit another query.