DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdlc2 and dnal4a

DIOPT Version :10

Sequence 1:NP_477408.1 Gene:Cdlc2 / 33319 FlyBaseID:FBgn0026141 Length:89 Species:Drosophila melanogaster
Sequence 2:XP_073795500.1 Gene:dnal4a / 445209 ZFINID:ZDB-GENE-040801-122 Length:124 Species:Danio rerio


Alignment Length:83 Identity:31/83 - (37%)
Similarity:52/83 - (62%) Gaps:2/83 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VIKNADMSEEMQQDAVDCATQALEKYNIEKDIAA-FIKKEFDKKYNPTWHCIVGRNFGSYVTHET 70
            :|::.||.|||:.:.::....|.||:....:.|| .||:..|||:..:||.::|..||..||||.
Zfish    40 LIRHTDMPEEMRVETMELCVTACEKFASNNESAAKMIKESMDKKFGSSWHVVIGEGFGFEVTHEV 104

  Fly    71 RHFIY-FYLGQVAILLFK 87
            |:.:| |:.|.:|:.::|
Zfish   105 RNLLYMFFGGSLAVCVWK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdlc2NP_477408.1 DLC-like_DYNLL1_DYNLL2 5..88 CDD:412000 31/83 (37%)
dnal4aXP_073795500.1 None

Return to query results.
Submit another query.