DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdlc2 and dynll1

DIOPT Version :10

Sequence 1:NP_477408.1 Gene:Cdlc2 / 33319 FlyBaseID:FBgn0026141 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_998189.1 Gene:dynll1 / 406297 ZFINID:ZDB-GENE-040426-1961 Length:89 Species:Danio rerio


Alignment Length:89 Identity:86/89 - (96%)
Similarity:89/89 - (100%) Gaps:0/89 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFGSY 65
            ||||||||||||||||||||||:|||||||||||||||||:||||||||||||||||||||||||
Zfish     1 MSDRKAVIKNADMSEEMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSY 65

  Fly    66 VTHETRHFIYFYLGQVAILLFKSG 89
            |||||:||||||||||||||||||
Zfish    66 VTHETKHFIYFYLGQVAILLFKSG 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdlc2NP_477408.1 DLC-like_DYNLL1_DYNLL2 5..88 CDD:412000 79/82 (96%)
dynll1NP_998189.1 DLC-like_DYNLL1_DYNLL2 5..88 CDD:412000 79/82 (96%)

Return to query results.
Submit another query.