DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and Ube2n

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:XP_006514407.1 Gene:Ube2n / 93765 MGIID:1934835 Length:171 Species:Mus musculus


Alignment Length:139 Identity:65/139 - (46%)
Similarity:84/139 - (60%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAPPVVIFRTP 92
            :|...:..:|.....|.|.|.|...:...|.||.||.:|.|.|||::|.|.|||.|.|.|.|.|.
Mouse    29 QETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTK 93

  Fly    93 IYHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDCNPKDPLMAKIGTEYLKNRAEHDKK 157
            |||.|:.:||.|||||||:||||||.|..:||||.:||:..||.|||...:..::..|.|:..:.
Mouse    94 IYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIET 158

  Fly   158 ARLWTKRYA 166
            ||.||:.||
Mouse   159 ARAWTRLYA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 65/139 (47%)
UQ_con 25..162 CDD:278603 61/133 (46%)
Ube2nXP_006514407.1 UBCc 29..170 CDD:381827 65/139 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.