DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and UBC13

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_010377.3 Gene:UBC13 / 851666 SGDID:S000002499 Length:153 Species:Saccharomyces cerevisiae


Alignment Length:147 Identity:73/147 - (49%)
Similarity:92/147 - (62%) Gaps:0/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SAVKRIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAPP 85
            |..|||.||.:::..||....:|.|.:|||..:..||.||..|.||:|||:|:::.|.:||...|
Yeast     3 SLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAP 67

  Fly    86 VVIFRTPIYHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDCNPKDPLMAKIGTEYLKN 150
            .|.|.|.|||.||.|||.||||:||..|||||.|..:||||.:||...||.|||...:..:::||
Yeast    68 KVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKN 132

  Fly   151 RAEHDKKARLWTKRYAK 167
            ......|||.|||.|||
Yeast   133 EQGAKAKAREWTKLYAK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 73/147 (50%)
UQ_con 25..162 CDD:278603 65/136 (48%)
UBC13NP_010377.3 UBCc 3..152 CDD:412187 73/147 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.