DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and UBC5

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_010344.1 Gene:UBC5 / 851631 SGDID:S000002466 Length:148 Species:Saccharomyces cerevisiae


Alignment Length:146 Identity:85/146 - (58%)
Similarity:109/146 - (74%) Gaps:0/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SAVKRIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAPP 85
            |:.|||.|||.::.||||..|||||..|:||.|.::|:||:||.|..|:|.|.|.||.:|||.||
Yeast     2 SSSKRIAKELSDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPP 66

  Fly    86 VVIFRTPIYHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDCNPKDPLMAKIGTEYLKN 150
            .|.|.|.|||.||:..|.|||||||::||||||:||:||||||||||.||.|||:.:|...|..:
Yeast    67 KVNFTTKIYHPNINSSGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKTD 131

  Fly   151 RAEHDKKARLWTKRYA 166
            :|:::..|:.|||:||
Yeast   132 KAKYEATAKEWTKKYA 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 85/146 (58%)
UQ_con 25..162 CDD:278603 78/136 (57%)
UBC5NP_010344.1 UBCc 3..147 CDD:412187 82/143 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.