DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and CDC34

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_010339.1 Gene:CDC34 / 851624 SGDID:S000002461 Length:295 Species:Saccharomyces cerevisiae


Alignment Length:163 Identity:48/163 - (29%)
Similarity:81/163 - (49%) Gaps:13/163 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SNSAVKRIQKELDEITRDPPQYCSAGPKEDNLYEWT-STIIGPADSVYENGIFKLDIFFPVEYPF 82
            ::|.:.|..:||.:..:..|.:......:.|::.|. ..::...||:|..|.||..:.||.::||
Yeast     8 ASSLLLRQYRELTDPKKAIPSFHIELEDDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPEDFPF 72

  Fly    83 APPVVIFRTPIYHCNIHRLGFICLDIL------------KEKWSPALTISKILLSICSLLTDCNP 135
            :||...|...|||.|::|.|.:|:.||            .|.|||..|:..:|:||.|||.|.|.
Yeast    73 SPPQFRFTPAIYHPNVYRDGRLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNI 137

  Fly   136 KDPLMAKIGTEYLKNRAEHDKKARLWTKRYAKD 168
            ..|.......:|.||..::.::.::..:|..:|
Yeast   138 NSPANVDAAVDYRKNPEQYKQRVKMEVERSKQD 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 47/161 (29%)
UQ_con 25..162 CDD:278603 45/149 (30%)
CDC34NP_010339.1 COG5078 3..170 CDD:227410 47/161 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.