DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and UBC8

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_568595.2 Gene:UBC8 / 834173 AraportID:AT5G41700 Length:149 Species:Arabidopsis thaliana


Alignment Length:146 Identity:82/146 - (56%)
Similarity:108/146 - (73%) Gaps:1/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AVKRIQKELDEITRDPPQYC-SAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAPP 85
            |.|||.|||.::.:|||..| .|||..::::.|.:||:|||:|.|..|:|.:.|.||.:|||.||
plant     2 ASKRILKELKDLQKDPPTSCIFAGPVAEDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPP 66

  Fly    86 VVIFRTPIYHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDCNPKDPLMAKIGTEYLKN 150
            .|.|||.::|.||:..|.||||||||:|||||||||:||||||||||.||.|||:.:|...|..:
plant    67 KVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 131

  Fly   151 RAEHDKKARLWTKRYA 166
            ||:::..||.||::||
plant   132 RAKYEATARNWTQKYA 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 82/146 (56%)
UQ_con 25..162 CDD:278603 76/137 (55%)
UBC8NP_568595.2 COG5078 1..148 CDD:227410 82/146 (56%)
UBCc 1..147 CDD:294101 80/144 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.