DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and FUS9

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_566459.2 Gene:FUS9 / 820557 AraportID:AT3G13550 Length:182 Species:Arabidopsis thaliana


Alignment Length:167 Identity:81/167 - (48%)
Similarity:113/167 - (67%) Gaps:4/167 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LFSAEDGTPSCSW---TCSNSAVKRIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVY 65
            :::...||.| ||   |..:::.||||:|:.|:..|||..||||||.||||.|.:|||||:.:.|
plant    17 MYAGYSGTAS-SWVAKTSVSASGKRIQREMAELNIDPPPDCSAGPKGDNLYHWIATIIGPSGTPY 80

  Fly    66 ENGIFKLDIFFPVEYPFAPPVVIFRTPIYHCNIHRLGFICLDILKEKWSPALTISKILLSICSLL 130
            |.|||.|||.||.:|||.||.::|:|.|||||:...|.:.::||::.|||||||:|:|.:|.|:.
plant    81 EGGIFFLDIIFPSDYPFKPPKLVFKTRIYHCNVDTAGDLSVNILRDSWSPALTITKVLQAIRSIF 145

  Fly   131 TDCNPKDPLMAKIGTEYLKNRAEHDKKARLWTKRYAK 167
            ....|..|.:..|...||.:|.:||:.|:.||.|:||
plant   146 LKPEPYSPALPVIARLYLTDREKHDEVAKEWTLRFAK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 75/149 (50%)
UQ_con 25..162 CDD:278603 69/136 (51%)
FUS9NP_566459.2 UBCc 39..177 CDD:238117 70/137 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.