DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and Ube2dnl2

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001075130.1 Gene:Ube2dnl2 / 75097 MGIID:1922347 Length:155 Species:Mus musculus


Alignment Length:150 Identity:86/150 - (57%)
Similarity:107/150 - (71%) Gaps:0/150 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TCSNSAVKRIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYP 81
            |....|:|||||||..|::|||.:|||||..:|::.|.:||:||.||.|:.|:|.|.:.||..||
Mouse     5 TLGAMALKRIQKELVAISQDPPAHCSAGPVAENMFHWQATIMGPEDSPYQGGVFFLSVHFPNNYP 69

  Fly    82 FAPPVVIFRTPIYHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDCNPKDPLMAKIGTE 146
            |.||.|.|.|.:||.||.:.|.||||||...|||||||||:||||||||.|.||.|||:.:|...
Mouse    70 FKPPKVTFITRVYHPNISKNGSICLDILNSMWSPALTISKLLLSICSLLCDPNPDDPLVPEIAKV 134

  Fly   147 YLKNRAEHDKKARLWTKRYA 166
            |.|:..|:::.||.||||||
Mouse   135 YRKDLREYNRLAREWTKRYA 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 84/147 (57%)
UQ_con 25..162 CDD:278603 77/136 (57%)
Ube2dnl2NP_001075130.1 COG5078 9..155 CDD:227410 84/145 (58%)
UBCc 9..154 CDD:294101 83/144 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833298
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.