DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and UBE2E2

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001357154.1 Gene:UBE2E2 / 7325 HGNCID:12478 Length:201 Species:Homo sapiens


Alignment Length:147 Identity:104/147 - (70%)
Similarity:118/147 - (80%) Gaps:0/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NSAVKRIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAP 84
            :::.|||||||.|||.|||..||||||.||:|||.|||:||..||||.|:|.|||.|..:|||.|
Human    54 STSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKP 118

  Fly    85 PVVIFRTPIYHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDCNPKDPLMAKIGTEYLK 149
            |.|.|||.||||||:..|.|||||||:.|||||||||:|||||||||||||.|||:..|.|:|:.
Human   119 PKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMT 183

  Fly   150 NRAEHDKKARLWTKRYA 166
            ||||||:.||.||||||
Human   184 NRAEHDRMARQWTKRYA 200

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 104/147 (71%)
UQ_con 25..162 CDD:278603 97/136 (71%)