DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and UBE2D3

DIOPT Version :10

Sequence 1:NP_608594.2 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_871622.1 Gene:UBE2D3 / 7323 HGNCID:12476 Length:149 Species:Homo sapiens


Alignment Length:143 Identity:79/143 - (55%)
Similarity:104/143 - (72%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KRIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAPPVVI 88
            |.:.|||.::.||||..|||||..|:::.|.:||:||.||.|:.|:|.|.|.||.:|||.||.|.
Human     6 KCLSKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVA 70

  Fly    89 FRTPIYHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDCNPKDPLMAKIGTEYLKNRAE 153
            |.|.|||.||:..|.||||||:.:|||||||||:||||||||.|.||.|||:.:|...|..:|.:
Human    71 FTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDK 135

  Fly   154 HDKKARLWTKRYA 166
            :::.:|.||::||
Human   136 YNRISREWTQKYA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_608594.2 UBCc_UBE2E 24..164 CDD:467413 77/139 (55%)
UBE2D3NP_871622.1 UBCc_UBE2D 6..147 CDD:467412 77/140 (55%)

Return to query results.
Submit another query.