DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and UBE2D2

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:XP_016865309.1 Gene:UBE2D2 / 7322 HGNCID:12475 Length:173 Species:Homo sapiens


Alignment Length:138 Identity:78/138 - (56%)
Similarity:102/138 - (73%) Gaps:0/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAPPVVIFRTPI 93
            ||:::.||||..|||||..|:::.|.:||:||.||.|:.|:|.|.|.||.:|||.||.|.|.|.|
Human    35 ELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRI 99

  Fly    94 YHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDCNPKDPLMAKIGTEYLKNRAEHDKKA 158
            ||.||:..|.||||||:.:|||||||||:||||||||.|.||.|||:.:|...|..:|.::::.|
Human   100 YHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIA 164

  Fly   159 RLWTKRYA 166
            |.||::||
Human   165 REWTQKYA 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 78/138 (57%)
UQ_con 25..162 CDD:278603 74/132 (56%)
UBE2D2XP_016865309.1 COG5078 35..173 CDD:227410 78/138 (57%)
UBCc 35..172 CDD:294101 76/136 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.