DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and Ube2q1

DIOPT Version :10

Sequence 1:NP_608594.2 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_081591.3 Gene:Ube2q1 / 70093 MGIID:1917343 Length:422 Species:Mus musculus


Alignment Length:162 Identity:42/162 - (25%)
Similarity:68/162 - (41%) Gaps:28/162 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SNSAVKRIQKELDEITRDPPQYCSAGP-----KEDNLYEWTSTIIG-PADSVYENGI-------- 69
            |..|..|:.|||.:|.|.  |....|.     ..|:||:|...::. ..||...|.:        
Mouse   249 SVQATDRLMKELRDIYRS--QSFKGGNYAVELVNDSLYDWNVKLLKVDQDSALHNDLQILKEKEG 311

  Fly    70 ---FKLDIFFPVEYPFAPPVVIFRTPIYHCN-IHRLGFICLDIL-KEKWSPALTISKILLSICSL 129
               ..|:..|...:||.||.|...:|:.... :...|.||:::| |:.||.|.:|..:::.|.:.
Mouse   312 ADFILLNFSFKDNFPFDPPFVRVVSPVLSGGYVLGGGAICMELLTKQGWSSAYSIESVIMQISAT 376

  Fly   130 LTDCNPKDPLMAKIG---TEYLKNRAEHDKKA 158
            |.    |.....:.|   ::|...||:...|:
Mouse   377 LV----KGKARVQFGANKSQYSLTRAQQSYKS 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_608594.2 UBCc_UBE2E 24..164 CDD:467413 40/157 (25%)
Ube2q1NP_081591.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..221
UBCc_UBE2Q 254..409 CDD:467422 40/157 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.