DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and Ube2t

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001265044.1 Gene:Ube2t / 67196 MGIID:1914446 Length:204 Species:Mus musculus


Alignment Length:149 Identity:62/149 - (41%)
Similarity:91/149 - (61%) Gaps:4/149 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAPPVVIF 89
            |::|||..:..:||...:...::|.:.:..:.|:|.|::.||.|:|.|::..|..|||.||.|.|
Mouse     6 RLKKELHMLAIEPPPGITCWQEKDQVADLRAQILGGANTPYEKGVFTLEVIIPERYPFEPPQVRF 70

  Fly    90 RTPIYHCNIHRLGFICLDIL----KEKWSPALTISKILLSICSLLTDCNPKDPLMAKIGTEYLKN 150
            .|||||.||...|.||||||    |..|.|:|.|:.:|.||..|:.:.||.|||||.|.:|:..|
Mouse    71 LTPIYHPNIDSSGRICLDILKLPPKGAWRPSLNIATVLTSIQLLMAEPNPDDPLMADISSEFKYN 135

  Fly   151 RAEHDKKARLWTKRYAKDE 169
            :....|||:.||:.:|:.:
Mouse   136 KIAFLKKAKQWTEAHARQK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 62/146 (42%)
UQ_con 25..162 CDD:278603 59/140 (42%)
Ube2tNP_001265044.1 COG5078 1..151 CDD:227410 61/144 (42%)
UBCc 5..147 CDD:238117 59/140 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..204 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.