DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and ube2l3

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:XP_031755551.1 Gene:ube2l3 / 548817 XenbaseID:XB-GENE-970758 Length:160 Species:Xenopus tropicalis


Alignment Length:141 Identity:51/141 - (36%)
Similarity:81/141 - (57%) Gaps:3/141 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ELDEITR-DPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAPPVVIFRTP 92
            ||:||.: ....:.:...::.||..|...|: |.:..|:.|.|:::|.||.||||.||.:.|:|.
 Frog    16 ELEEIRKTGMKNFRNIQVEDSNLLTWQGLIV-PDNPPYDKGAFRIEINFPAEYPFKPPKITFKTK 79

  Fly    93 IYHCNIHRLGFICLDILK-EKWSPALTISKILLSICSLLTDCNPKDPLMAKIGTEYLKNRAEHDK 156
            |||.||...|.:||.::. |.|.||....:::.|:.:|:.|..|:.||.|.:..||.|:|.:..|
 Frog    80 IYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCK 144

  Fly   157 KARLWTKRYAK 167
            .|..:||:|.:
 Frog   145 NAEEFTKKYGE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 51/141 (36%)
UQ_con 25..162 CDD:278603 48/134 (36%)
ube2l3XP_031755551.1 UBCc 16..155 CDD:214562 51/139 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.