DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and ube2ka

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001013500.1 Gene:ube2ka / 541355 ZFINID:ZDB-GENE-050320-48 Length:200 Species:Danio rerio


Alignment Length:148 Identity:57/148 - (38%)
Similarity:83/148 - (56%) Gaps:4/148 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SNSAVKRIQKELDEITRD---PPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEY 80
            :|.||:||::|..|:.:.   ..........::|..|....|.||.|:.||.|.::|:|..|..|
Zfish     2 ANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETY 66

  Fly    81 PFAPPVVIFRTPIYHCNIHRL-GFICLDILKEKWSPALTISKILLSICSLLTDCNPKDPLMAKIG 144
            ||.||.|.|.|.|:|.||..: |.|||||||.:|:.|:|:..:|||:.:||....|.||..|.:.
Zfish    67 PFNPPKVRFITKIWHPNISSVTGAICLDILKGQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVA 131

  Fly   145 TEYLKNRAEHDKKARLWT 162
            .:|.:|.....:.||||:
Zfish   132 NQYKQNPEMFKQTARLWS 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 57/148 (39%)
UQ_con 25..162 CDD:278603 53/140 (38%)
ube2kaNP_001013500.1 COG5078 1..148 CDD:227410 55/145 (38%)
UBCc 6..148 CDD:238117 53/141 (38%)
UBA_like_SF 163..200 CDD:304366
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.