DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and CG5823

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster


Alignment Length:120 Identity:37/120 - (30%)
Similarity:59/120 - (49%) Gaps:9/120 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SAVKRIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAPP 85
            :||.|::::...:.|||..|.:|.|..:|:.||...:.||.||.|..|.:...:.||.|:||.||
  Fly    14 TAVSRMKQDYMRLKRDPLPYITAEPLPNNILEWHYCVKGPEDSPYYGGYYHGTLLFPREFPFKPP 78

  Fly    86 VVIFRTP--IYHCNIHRLGFICL---DILKEKWSPALTISKILLSICSLLTDCNP 135
            .:...||  .:..|..    :||   |...:.|:|...:..||..:.|.:.:..|
  Fly    79 SIYMLTPNGRFKTNTR----LCLSISDFHPDTWNPTWCVGTILTGLLSFMLESTP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 37/120 (31%)
UQ_con 25..162 CDD:278603 35/116 (30%)
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 35/116 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.