DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and Ubc84D

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster


Alignment Length:149 Identity:41/149 - (27%)
Similarity:83/149 - (55%) Gaps:3/149 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SAVKRIQKELDEITRDPPQYC-SAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAP 84
            :|.:|:.:||.::........ :....:::|..||..:: |..:.|..|.|:::|.||.:|||.|
  Fly     2 AATRRLTRELSDLVEAKMSTLRNIESSDESLLMWTGLLV-PEKAPYNKGAFRIEINFPPQYPFMP 65

  Fly    85 PVVIFRTPIYHCNIHRLGFICLDILK-EKWSPALTISKILLSICSLLTDCNPKDPLMAKIGTEYL 148
            |.::|:|.|||.|:...|.:||.|:. :.|.|.....::|.::.:::.:..|:.||.:.:..|::
  Fly    66 PKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEEFV 130

  Fly   149 KNRAEHDKKARLWTKRYAK 167
            :...:..|.|..:||:.|:
  Fly   131 REHKKFMKTAEEFTKKNAE 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 41/149 (28%)
UQ_con 25..162 CDD:278603 37/138 (27%)
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 41/149 (28%)
UBCc 6..149 CDD:214562 39/143 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442227
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.