DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and CG17030

DIOPT Version :10

Sequence 1:NP_608594.2 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster


Alignment Length:147 Identity:43/147 - (29%)
Similarity:81/147 - (55%) Gaps:4/147 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KRIQKELDEITRDPP--QYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAPPV 86
            ||:.:||..:..|..  |:.:...:.:|:|:||..:: |....|:.|.:|::|.||::|||.||.
  Fly    13 KRMNRELALMLEDKQNLQFRNLLVEPNNIYKWTGLLM-PVAPPYDKGAYKMEIDFPLDYPFKPPR 76

  Fly    87 VIFRTPIYHCNIHRLGFICLDILK-EKWSPALTISKILLSICSLLTDCNPKDPLMAKIGTEYLKN 150
            :...|.:||.|::..|.:|:.||: |.|.|...|.::|..:.:.:.|..|::....::..||..:
  Fly    77 IHINTRMYHLNVNERGQVCVPILEVEHWIPTTRIDQVLQVLLATINDPQPENAWHIEMAGEYRND 141

  Fly   151 RAEHDKKARLWTKRYAK 167
            .....|.|..|.::|::
  Fly   142 PVRFFKMADAWVQKYSE 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_608594.2 UBCc_UBE2E 24..164 CDD:467413 42/142 (30%)
CG17030NP_647941.1 UBCc_UBE2L3 11..158 CDD:467421 43/145 (30%)

Return to query results.
Submit another query.