DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and Ube2d1

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:XP_017457176.1 Gene:Ube2d1 / 361831 RGDID:1307886 Length:194 Species:Rattus norvegicus


Alignment Length:138 Identity:75/138 - (54%)
Similarity:101/138 - (73%) Gaps:0/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAPPVVIFRTPI 93
            ||.::.||||.:|||||..|:|:.|.:||:||.||.|:.|:|.|.:.||.:|||.||.:.|.|.|
  Rat    56 ELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKI 120

  Fly    94 YHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDCNPKDPLMAKIGTEYLKNRAEHDKKA 158
            ||.||:..|.||||||:.:||||||:||:||||||||.|.||.|||:..|...|..::.::::.|
  Rat   121 YHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHA 185

  Fly   159 RLWTKRYA 166
            |.||::||
  Rat   186 REWTQKYA 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 75/138 (54%)
UQ_con 25..162 CDD:278603 71/132 (54%)
Ube2d1XP_017457176.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.