DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and CG7220

DIOPT Version :10

Sequence 1:NP_608594.2 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_724964.2 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster


Alignment Length:147 Identity:51/147 - (34%)
Similarity:76/147 - (51%) Gaps:16/147 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KRIQKELDEITRDPPQYCSAGPK--EDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAPPV 86
            :|:.|||..:.::||...:...:  :.||.||...|.|...::||...|:|...|..:|||..|.
  Fly    45 RRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSPE 109

  Fly    87 VIF---RTPIYHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDC----NPKDPLMAKIG 144
            |.|   ..|: |.:::..|.|||.||.|.|||||::..:.|||.|:|:.|    .|.|      .
  Fly   110 VTFIGTNIPV-HPHVYSNGHICLSILTEDWSPALSVQSVCLSIASMLSSCREKKRPPD------N 167

  Fly   145 TEYLKNRAEHDKKARLW 161
            |.|:|...::.||.:.|
  Fly   168 TIYVKTCNKNPKKTKWW 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_608594.2 UBCc_UBE2E 24..164 CDD:467413 51/147 (35%)
CG7220NP_724964.2 UBCc_UBE2W 44..164 CDD:467428 43/119 (36%)

Return to query results.
Submit another query.