DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and Ubc2

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster


Alignment Length:156 Identity:112/156 - (71%)
Similarity:121/156 - (77%) Gaps:1/156 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TPSCSWTCSNSAVKRIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIF 75
            ||..|.....|| |||||||.|||.|||..||||||.||||||.|||:||..||||.|:|.|||.
  Fly    77 TPRISRALGTSA-KRIQKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIH 140

  Fly    76 FPVEYPFAPPVVIFRTPIYHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDCNPKDPLM 140
            |..||||.||.|.|||.||||||:..|.|||||||:.|||||||||:|||||||||||||.|||:
  Fly   141 FSPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLV 205

  Fly   141 AKIGTEYLKNRAEHDKKARLWTKRYA 166
            ..|.|:||:||.|||:.|||||||||
  Fly   206 GSIATQYLQNREEHDRIARLWTKRYA 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 109/148 (74%)
UQ_con 25..162 CDD:278603 100/136 (74%)
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 107/145 (74%)
UQ_con 90..227 CDD:278603 100/136 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451042
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S139
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103748at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.