DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and CG4502

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster


Alignment Length:152 Identity:36/152 - (23%)
Similarity:69/152 - (45%) Gaps:13/152 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KRIQKELDEITRDPPQYCSAGPKE---DNLYEW--TSTIIGP----ADSVYENGI--FKLDIFFP 77
            :|:.||..|:.|...:..:....|   |:|:||  ...:|.|    |..:.|.|:  ..|.:.||
  Fly   141 RRLMKEYREMERLQAKNDAVFTVELVNDSLFEWHVRLHVIDPDSPLARDMAEMGVPAILLHLSFP 205

  Fly    78 VEYPFAPPVV-IFRTPIYHCNIHRLGFICLDILKEK-WSPALTISKILLSICSLLTDCNPKDPLM 140
            ..:|||||.: :....|....:...|.||:::|..: |:.|.|:..:::...:.:.....:....
  Fly   206 DNFPFAPPFMRVVEPHIEKGYVMEGGAICMELLTPRGWASAYTVEAVIMQFAASVVKGQGRIARK 270

  Fly   141 AKIGTEYLKNRAEHDKKARLWT 162
            .|...|:.:.:||...::.:.|
  Fly   271 PKSTKEFTRRQAEESFRSLVKT 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 36/152 (24%)
UQ_con 25..162 CDD:278603 35/149 (23%)
CG4502NP_609103.1 UBCc 140..>258 CDD:238117 31/116 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442224
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.