DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and ben

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster


Alignment Length:150 Identity:69/150 - (46%)
Similarity:95/150 - (63%) Gaps:0/150 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NSAVKRIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAP 84
            :|..:||.||...:.::|....:|.|.|:|...:...:.||.||.:|.|:|||::|.|.:||.:.
  Fly     2 SSLPRRIIKETQRLMQEPVPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMSA 66

  Fly    85 PVVIFRTPIYHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDCNPKDPLMAKIGTEYLK 149
            |.|.|.|.|||.||.|||.||||:||:||||||.|..|||||.:||:..||.|||...:...:..
  Fly    67 PKVRFITKIYHPNIDRLGRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDDPLANDVAELWKV 131

  Fly   150 NRAEHDKKARLWTKRYAKDE 169
            |.||..:.||.||::||.::
  Fly   132 NEAEAIRNAREWTQKYAVED 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 69/147 (47%)
UQ_con 25..162 CDD:278603 64/136 (47%)
benNP_001162752.1 UBCc 3..149 CDD:412187 68/145 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.