DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and CG2924

DIOPT Version :10

Sequence 1:NP_608594.2 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_569994.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster


Alignment Length:130 Identity:37/130 - (28%)
Similarity:57/130 - (43%) Gaps:19/130 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SNSAVKRIQKELDEITRD---PPQYCSAGPKEDNLYEWTSTI--IGPADSVYENGI--------- 69
            |..|..|:.|||.:|.|.   .....|.....:::|||...:  :.| ||...:.:         
  Fly   220 SVQATDRLMKELRDIYRSDAFKKNMYSIELVNESIYEWNIRLKSVDP-DSPLHSDLQMLKEKEGK 283

  Fly    70 --FKLDIFFPVEYPFAPPVVIFRTPIYHCNIHRL-GFICLDIL-KEKWSPALTISKILLSICSLL 130
              ..|:|.|...|||.||.|....||.......: |.||:::| |:.||.|.|:..:::.|.:.|
  Fly   284 DSILLNILFKETYPFEPPFVRVVHPIISGGYVLIGGAICMELLTKQGWSSAYTVEAVIMQIAATL 348

  Fly   131  130
              Fly   349  348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_608594.2 UBCc_UBE2E 24..164 CDD:467413 35/125 (28%)
CG2924NP_569994.1 UBCc_UBE2Q 225..384 CDD:467422 35/125 (28%)

Return to query results.
Submit another query.