DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and CG2924

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster


Alignment Length:130 Identity:37/130 - (28%)
Similarity:57/130 - (43%) Gaps:19/130 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SNSAVKRIQKELDEITRD---PPQYCSAGPKEDNLYEWTSTI--IGPADSVYENGI--------- 69
            |..|..|:.|||.:|.|.   .....|.....:::|||...:  :.| ||...:.:         
  Fly   220 SVQATDRLMKELRDIYRSDAFKKNMYSIELVNESIYEWNIRLKSVDP-DSPLHSDLQMLKEKEGK 283

  Fly    70 --FKLDIFFPVEYPFAPPVVIFRTPIYHCNIHRL-GFICLDIL-KEKWSPALTISKILLSICSLL 130
              ..|:|.|...|||.||.|....||.......: |.||:::| |:.||.|.|:..:::.|.:.|
  Fly   284 DSILLNILFKETYPFEPPFVRVVHPIISGGYVLIGGAICMELLTKQGWSSAYTVEAVIMQIAATL 348

  Fly   131  130
              Fly   349  348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 37/130 (28%)
UQ_con 25..162 CDD:278603 35/124 (28%)
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 35/126 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442218
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.