DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and Ube2c

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001100012.1 Gene:Ube2c / 296368 RGDID:1305382 Length:179 Species:Rattus norvegicus


Alignment Length:164 Identity:62/164 - (37%)
Similarity:83/164 - (50%) Gaps:19/164 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GTPSCSWTCSNSAVKRIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDI 74
            |...|.........||:|:||..:.....:..||.|:.|||::|..||.|.|.:|||:..:||.:
  Rat    19 GAEPCGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSL 83

  Fly    75 FFPVEYPFAPPVVIFRTPIYHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDCNPKDPL 139
            .||..||:..|.|.|.||.||.|:...|.|||||||:|||....:..|||||.|||.:.|.:.||
  Rat    84 EFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKDKWSALYDVRTILLSIQSLLGEPNIESPL 148

  Fly   140 MAKIGTEYLKNRAEHDKKARLWT-----KRYAKD 168
                          :...|.||.     |:|.::
  Rat   149 --------------NTHAAELWKNPTAFKKYLQE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 60/153 (39%)
UQ_con 25..162 CDD:278603 56/136 (41%)
Ube2cNP_001100012.1 COG5078 33..172 CDD:227410 60/150 (40%)
UQ_con 34..170 CDD:278603 59/149 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.