DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and Ube2l6

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001019926.1 Gene:Ube2l6 / 295704 RGDID:1307960 Length:153 Species:Rattus norvegicus


Alignment Length:150 Identity:47/150 - (31%)
Similarity:77/150 - (51%) Gaps:3/150 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SAVKRIQKELDEITRDPPQYCSAGPKED-NLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAP 84
            :|.||:.||||:::::.|.|......:| |:..|...:: |....|....|.|.|.||.|||..|
  Rat     2 TASKRVAKELDDLSKELPPYLRHLSSDDANVLVWHMLLL-PDQLPYRLKAFGLRIDFPREYPLKP 65

  Fly    85 PVVIFRTPIYHCNIHRLGFICLDILK-EKWSPALTISKILLSICSLLTDCNPKDPLMAKIGTEYL 148
            |.:.|.|.|||.||...|.:||.::. |.|.|.....::|.::..|::..|.::|:..::.....
  Rat    66 PTLRFTTKIYHPNISEDGLVCLPLISTENWKPYTKAYQVLEALNILVSRPNLEEPVRLELADLLT 130

  Fly   149 KNRAEHDKKARLWTKRYAKD 168
            ::.....|||..:|.:|..|
  Rat   131 QDPEMFRKKAEEFTLQYGVD 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 46/148 (31%)
UQ_con 25..162 CDD:278603 42/138 (30%)
Ube2l6NP_001019926.1 COG5078 1..147 CDD:227410 45/145 (31%)
UQ_con 6..144 CDD:278603 42/138 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.