DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and Ube2q1

DIOPT Version :10

Sequence 1:NP_608594.2 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:XP_063137686.1 Gene:Ube2q1 / 295252 RGDID:1305305 Length:473 Species:Rattus norvegicus


Alignment Length:167 Identity:41/167 - (24%)
Similarity:69/167 - (41%) Gaps:32/167 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SNSAVKRIQKELDEITRDPPQYCSAGP-----KEDNLYEWTSTIIG-PADSVYENGI-------- 69
            |..|..|:.|||.:|.|.  |....|.     ..|:||:|...::. ..||...|.:        
  Rat   249 SVQATDRLMKELRDIYRS--QSFKGGNYAVELVNDSLYDWNVKLLKVDQDSALHNDLQILKEKEG 311

  Fly    70 ---FKLDIFFPVEYPFAPPVVIFRTPIYHCN-IHRLGFICLDIL-KEKWSPALTISKILLSICSL 129
               ..|:..|...:||.||.|...:|:.... :...|.||:::| |:.||.|.:|..:::.|.:.
  Rat   312 ADFILLNFSFKDNFPFDPPFVRVVSPVLSGGYVLGGGAICMELLTKQGWSSAYSIESVIMQISAT 376

  Fly   130 LTDCNPKDPLMAKIGTEYLKNRAEHDKKARLWTKRYA 166
            |        :..|...::..|:.   :...||..:|:
  Rat   377 L--------VKGKARVQFGANKV---RTLGLWGAKYS 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_608594.2 UBCc_UBE2E 24..164 CDD:467413 38/158 (24%)
Ube2q1XP_063137686.1 None

Return to query results.
Submit another query.