DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and ubc14

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_594859.1 Gene:ubc14 / 2541565 PomBaseID:SPAC1250.03 Length:155 Species:Schizosaccharomyces pombe


Alignment Length:152 Identity:58/152 - (38%)
Similarity:88/152 - (57%) Gaps:1/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TCSNSAVKRIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYP 81
            :.|.|:.:|:.||..::...|.........:|||:.|..|.:||:||||..|.|...:.||::||
pombe     3 SASPSSSRRLTKEYSDLREHPIPDIRVNLVDDNLFHWACTALGPSDSVYAGGKFHFSLKFPLDYP 67

  Fly    82 FAPPVVIFRTPIYHCNIHRLGFICLDILKEK-WSPALTISKILLSICSLLTDCNPKDPLMAKIGT 145
            |.||.:.|.|.|||.|....|.:||.|||:: :.|::.:..:|..|..||.:.||.|||:|.|..
pombe    68 FQPPTIEFTTRIYHPNFDSEGNVCLAILKQQVFKPSIKLRSVLEQILQLLREPNPDDPLVASIAE 132

  Fly   146 EYLKNRAEHDKKARLWTKRYAK 167
            :|..:|...||.||.:.:::||
pombe   133 QYRNDRPSFDKIARDYVEQFAK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 58/150 (39%)
UQ_con 25..162 CDD:278603 54/137 (39%)
ubc14NP_594859.1 COG5078 12..154 CDD:227410 53/141 (38%)
UQ_con 12..149 CDD:278603 53/136 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.