DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and Ube2d1

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:XP_006513541.1 Gene:Ube2d1 / 216080 MGIID:2384911 Length:160 Species:Mus musculus


Alignment Length:152 Identity:80/152 - (52%)
Similarity:108/152 - (71%) Gaps:4/152 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SWTCSNSAVKRIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVE 79
            ||:..    :.|||||.::.||||.:|||||..|:|:.|.:||:||.||.|:.|:|.|.:.||.:
Mouse    12 SWSWG----EWIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTD 72

  Fly    80 YPFAPPVVIFRTPIYHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDCNPKDPLMAKIG 144
            |||.||.:.|.|.|||.||:..|.||||||:.:||||||:||:||||||||.|.||.|||:..|.
Mouse    73 YPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIA 137

  Fly   145 TEYLKNRAEHDKKARLWTKRYA 166
            ..|..::.::::.||.||::||
Mouse   138 QIYKSDKEKYNRHAREWTQKYA 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 78/148 (53%)
UQ_con 25..162 CDD:278603 74/136 (54%)
Ube2d1XP_006513541.1 UBCc 19..159 CDD:381827 76/139 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.