DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and C28G1.10

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001257066.1 Gene:C28G1.10 / 13222010 WormBaseID:WBGene00219376 Length:203 Species:Caenorhabditis elegans


Alignment Length:159 Identity:53/159 - (33%)
Similarity:77/159 - (48%) Gaps:19/159 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NSAVKRIQKELDEITRDPPQYCSAGPK----------EDNLYEWTSTIIGPADSVYENGIFKLDI 74
            ::|.||:..||       ..|.|....          |.|:......|.|..::.||.|||:|||
 Worm     2 STASKRVTNEL-------RNYYSCVSSVDTGIRIKVIEGNIMHLKGIIKGVEETPYEGGIFELDI 59

  Fly    75 FFPVEYPFAPPVVIFRTPIYHCNIHRL-GFICL-DILKEKWSPALTISKILLSICSLLTDCNPKD 137
            .....|||..|.|.|.|.|:|.::... |.||| |:....|..::||.|:|:.|.|.:::.|.|:
 Worm    60 KIGESYPFKAPTVKFITKIWHPSVSPFDGTICLHDVDNGVWPVSMTIYKVLIVIQSWMSNFNEKE 124

  Fly   138 PLMAKIGTEYLKNRAEHDKKARLWTKRYA 166
            |:..:|..:...||...:|.|..||||:|
 Worm   125 PIDVEILEQATNNREVFEKTAEFWTKRFA 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 53/159 (33%)
UQ_con 25..162 CDD:278603 46/148 (31%)
C28G1.10NP_001257066.1 UBCc 5..149 CDD:238117 47/150 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.