DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and Birc6

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:XP_006523581.1 Gene:Birc6 / 12211 MGIID:1276108 Length:4953 Species:Mus musculus


Alignment Length:174 Identity:51/174 - (29%)
Similarity:84/174 - (48%) Gaps:29/174 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SNSA--VKRIQKELDEITRDPPQYCSAGP----KEDNLYEWTSTIIGPADSVYENGIFKLDIFFP 77
            :|||  .:|:.:|...::...|...|:..    .|:.|......|.||||:.|.||.|:.|::||
Mouse  4665 ANSAARARRLAQEAVTLSTSLPLSSSSSVFVRCDEERLDIMKVLITGPADTPYANGCFEFDVYFP 4729

  Fly    78 VEYPFAPPVVIFRTPIYHC-----NIHRLGFICLDIL-------KEKWSP-ALTISKILLSICSL 129
            .:||.:||:|...|...|.     |::..|.:||.||       :|||:| ..:..::|:|:.||
Mouse  4730 QDYPSSPPLVNLETTGGHSVRFNPNLYNDGKVCLSILNTWHGRPEEKWNPQTSSFLQVLVSVQSL 4794

  Fly   130 LTDCNP--KDPLMAK-----IGTEYLKNRAEHDKKARLWTKRYA 166
            :....|  .:|...:     .||:   :..|:|...|..|.::|
Mouse  4795 ILVAEPYFNEPGYERSRGTPSGTQ---SSREYDGNIRQATVKWA 4835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 51/174 (29%)
UQ_con 25..162 CDD:278603 46/160 (29%)
Birc6XP_006523581.1 BIR 347..420 CDD:237989
BIRC6 3558..3712 CDD:372067
UBCc 4693..4831 CDD:238117 42/140 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.