DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and UBE2E3

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001265483.1 Gene:UBE2E3 / 10477 HGNCID:12479 Length:207 Species:Homo sapiens


Alignment Length:147 Identity:105/147 - (71%)
Similarity:118/147 - (80%) Gaps:0/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NSAVKRIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAP 84
            :::.|||||||.|||.|||..||||||.||:|||.|||:||..||||.|:|.|||.|..:|||.|
Human    60 STSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKP 124

  Fly    85 PVVIFRTPIYHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDCNPKDPLMAKIGTEYLK 149
            |.|.|||.||||||:..|.|||||||:.|||||||||:|||||||||||||.|||:..|.|:||.
Human   125 PKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLT 189

  Fly   150 NRAEHDKKARLWTKRYA 166
            ||||||:.||.||||||
Human   190 NRAEHDRIARQWTKRYA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 105/147 (71%)
UQ_con 25..162 CDD:278603 98/136 (72%)
UBE2E3NP_001265483.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 0/2 (0%)
UQ_con 65..202 CDD:395127 98/136 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S139
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.