DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and Ube2e1

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:XP_038949665.1 Gene:Ube2e1 / 100366017 RGDID:2324438 Length:310 Species:Rattus norvegicus


Alignment Length:147 Identity:104/147 - (70%)
Similarity:118/147 - (80%) Gaps:0/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NSAVKRIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAP 84
            :::.|||||||.:||.|||..||||||.||:|||.|||:||..||||.|:|.|||.|..||||.|
  Rat   163 STSAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKP 227

  Fly    85 PVVIFRTPIYHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDCNPKDPLMAKIGTEYLK 149
            |.|.|||.||||||:..|.|||||||:.|||||||||:|||||||||||||.|||:..|.|:|:.
  Rat   228 PKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMT 292

  Fly   150 NRAEHDKKARLWTKRYA 166
            ||||||:.||.||||||
  Rat   293 NRAEHDRMARQWTKRYA 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 104/147 (71%)
UQ_con 25..162 CDD:278603 97/136 (71%)
Ube2e1XP_038949665.1 PHA03378 <19..>108 CDD:223065
UQ_con 168..305 CDD:395127 97/136 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.