DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and ube2c

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001095283.1 Gene:ube2c / 100124324 XenbaseID:XB-GENE-971108 Length:179 Species:Xenopus tropicalis


Alignment Length:158 Identity:62/158 - (39%)
Similarity:87/158 - (55%) Gaps:6/158 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAEDGTPSCSWTCSNSAVKRIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIF 70
            :|..|..|.:.....|..||:|:||..:.....:..||.|:.|||::|..||.|...:|||:..:
 Frog    15 TARKGQESGTSAARGSVGKRLQQELMTLMMSGDKGISAFPESDNLFKWIGTIDGAVGTVYESLRY 79

  Fly    71 KLDIFFPVEYPFAPPVVIFRTPIYHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDCN- 134
            ||.:.||..||:..|.|.|.||.:|.|:...|.|||||||:|||....:..||||:.|||.:.| 
 Frog    80 KLSLEFPSGYPYNAPTVKFVTPCFHPNVDSHGNICLDILKDKWSALYDVRTILLSLQSLLGEPNN 144

  Fly   135 --PKDPLMAKI---GTEYLKNRAEHDKK 157
              |.:|..|::   .|.|.|:..|..:|
 Frog   145 ESPLNPYAAELWQNQTAYKKHLHEQYQK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 59/145 (41%)
UQ_con 25..162 CDD:278603 57/139 (41%)
ube2cNP_001095283.1 UQ_con 34..170 CDD:365926 56/135 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.