DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5440 and ube2d4

DIOPT Version :9

Sequence 1:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001082922.1 Gene:ube2d4 / 100001914 ZFINID:ZDB-GENE-070424-86 Length:147 Species:Danio rerio


Alignment Length:145 Identity:83/145 - (57%)
Similarity:108/145 - (74%) Gaps:0/145 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AVKRIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAPPV 86
            |:|||||||.::.||||..|||||..::|:.|.:||:||.||.|:.|:|.|.|.||.:|||.||.
Zfish     2 ALKRIQKELTDLQRDPPAQCSAGPVGEDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPK 66

  Fly    87 VIFRTPIYHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDCNPKDPLMAKIGTEYLKNR 151
            |.|.|.|||.||:..|.||||||:.:||||||:||:||||||||.|.||.|||:.:|...|..:|
Zfish    67 VAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADR 131

  Fly   152 AEHDKKARLWTKRYA 166
            .::::.||.||::||
Zfish   132 EKYNRLAREWTQKYA 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 83/145 (57%)
UQ_con 25..162 CDD:278603 77/136 (57%)
ube2d4NP_001082922.1 UBCc 1..146 CDD:412187 81/143 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.