DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a5 and MRPL35

DIOPT Version :9

Sequence 1:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_010608.1 Gene:MRPL35 / 851921 SGDID:S000002730 Length:367 Species:Saccharomyces cerevisiae


Alignment Length:211 Identity:58/211 - (27%)
Similarity:103/211 - (48%) Gaps:40/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IMKEMEVIPEILDE----PPRELLRIKYDNTID----IEEGKTYTPTELKFQPRLD------WNA 79
            :|:.:|.:..|.|.    .||..:.||:..:..    ||.|:..:......:|...      .|.
Yeast   155 LMQRLETLAAIPDTLPTLVPRAEVNIKFPFSTGVNKWIEPGEFLSSNVTSMRPIFKIQEYELVNV 219

  Fly    80 DPESFYTVLMICPDAPNRENPMYRSWLHWLVVNV------PGLDIMK---GQPISEYFGPLPPKD 135
            : :..||||::.||.|:..|..:::.|.:.:||:      ..:|..|   ...|::|..|:|.|:
Yeast   220 E-KQLYTVLIVNPDVPDLSNDSFKTALCYGLVNINLTYNDNLIDPRKFHSSNIIADYLPPVPEKN 283

  Fly   136 SGIQRYLILVYQQ---SDK-----LDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQS 192
            :|.||:::.|::|   .||     |:.|.|  |||..|    ||:.:||:||.: :.:..:|::|
Yeast   284 AGKQRFVVWVFRQPLIEDKQGPNMLEIDRK--ELSRDD----FDIRQFTKKYNL-TAIGAHIWRS 341

  Fly   193 RWDEYVPELMKTLYGV 208
            .||..| ..::..||:
Yeast   342 EWDAKV-AAVREKYGL 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 46/171 (27%)
MRPL35NP_010608.1 PEBP_euk 178..341 CDD:176644 46/170 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46533
orthoMCL 1 0.900 - - OOG6_111451
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.